Bacterial taxon 909946
Locus STM474_4356
Protein WP_001044509.1
DNA-binding protein HU-alpha
Salmonella enterica Serovar Typhimurium ST4 74
Length 90 aa, Gene hupA, UniProt E8XLB6
>WP_001044509.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-binding protein HU-alpha
MNKTQLIDVIADKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,408,126 | -5.14 | 0.00031 | ●●●○○ -2.49 | -2.49087250399253 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,408,126 | -2.71 | 7.0e-8 | ●●○○○ -1.23 | -1.22912641893594 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,408,126 | -0.93 | 0.75 | ●○○○○ -0.31 | -0.307878779166998 | 23637626 |
Retrieved 3 of 3 entries in 55.1 ms
(Link to these results)