Bacterial taxon 909946
Locus STM474_2179
Protein WP_000973708.1
dTDP-4-dehydrorhamnose 3,5-epimerase
Salmonella enterica Serovar Typhimurium ST4 74
Length 183 aa, Gene rfbC, UniProt E8XC48
>WP_000973708.1|Salmonella enterica Serovar Typhimurium ST4 74|dTDP-4-dehydrorhamnose 3,5-epimerase
MMIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLRGLHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSEYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPFSQLPELSAKDAAAPLLDQALLTE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,172,843 | -5.48 | 9.0e-18 | ●●●○○ -2.67 | -2.66706286362776 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,172,843 | -2.08 | 0.073 | ●○○○○ -0.9 | -0.903214963340991 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,172,843 | 1.18 | 0.61 | ○○○○○ 0.79 | 0.788161953083687 | 23637626 |
Retrieved 3 of 3 entries in 22.7 ms
(Link to these results)