Bacterial taxon 909946
Locus STM474_4701
Protein WP_000864857.1
DUF1062 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 202 aa, Gene n/a, UniProt E8XCE3
>WP_000864857.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1062 domain-containing protein
MKVIWTVTPVGYQRIAKRCPSCSVKRDFTPSGAFRVNSQKKVLDVWSIYKCTHCDYTWNISLFSRLPVSKINRDLYCRLMANDAATVQYFAYDNAILKRNNAELSGQPDFHIQERWLVSIASHKQVSVSVRISRSFQVSLLSILKKQLLLSAAEIKRRIETGQISGVTMKMLKSRKLKNAKYDLQLSVETLYDRRRIVLTCR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,776,919 | -8.09 | 4.7e-30 | ●●●●● -4.02 | -4.02489429625233 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,776,919 | -3.56 | 0.0001 | ●●○○○ -1.67 | -1.6716992654331 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,777,354 | -3.55 | 6.0e-15 | ●●○○○ -1.67 | -1.66864234684329 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,776,919 | -1.52 | 0.27 | ●○○○○ -0.61 | -0.613616683706756 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,777,354 | -1.39 | 0.17 | ●○○○○ -0.54 | -0.543634422694489 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,777,354 | -1.33 | 0.38 | ●○○○○ -0.52 | -0.515451196091046 | 23637626 |
Retrieved 6 of 6 entries in 1 ms
(Link to these results)