Bacterial taxon 909946
Locus STM474_2243
Protein WP_000703137.1
DUF1307 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 152 aa, Gene yehR, UniProt E8XCZ6
>WP_000703137.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1307 domain-containing protein
MKISGKLLSAALASVLVFSLAGCGDKEESKTFNANLAGTEISITYTYKGDKIIKQTSESKISYATVGAKTKEDAAKILDPLSAKYKNIAGVEEKLTYEDTYAQENVSVDMEKVDFKALQQISGTMVSGDTSKGISMKQTQTLLEAAGFKEAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,250,130 | -5.12 | 1.7e-19 | ●●●○○ -2.48 | -2.48066673217012 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,250,130 | -1.89 | 0.24 | ●○○○○ -0.8 | -0.802005935202039 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,250,130 | -0.89 | 0.74 | ●○○○○ -0.28 | -0.283215547207225 | 23637626 |
Retrieved 3 of 3 entries in 38.3 ms
(Link to these results)