Bacterial taxon 909946
Locus STM474_3352
Protein WP_000171739.1
DUF1449 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 206 aa, Gene n/a, UniProt E8XBC7
>WP_000171739.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1449 family protein
MTLFAEYNSPYLFAIAFVFFIGVLEMISLIFGHFLSGALDAHLDHYDALSSGPAGQALHYLNIGRVPALVVLCLLAGYFGLFGILIQHGGIMLWQAPLSNLLLVPLSIVLSVFAVHYSGKILAPWLPRDESSALREEEFIGGMAIITGHAAVAGTPCEGKFTDKFGQIHYLLLEPEKGKEFKKGDKVLIVCRLSATRYLAERTFYV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,380,948 | -9.64 | 5.9e-24 | ●●●●● -4.83 | -4.82700804618048 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,380,948 | -6.57 | 1.6e-5 | ●●●●○ -3.24 | -3.23683693139239 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,380,948 | -6.46 | 2.0e-7 | ●●●●○ -3.18 | -3.17569898335708 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,380,498 | -1.24 | 0.016 | ●○○○○ -0.47 | -0.467170352111806 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,380,498 | -0.66 | 0.8 | ●○○○○ -0.16 | -0.163801933684353 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,380,498 | 2.32 | 0.28 | ○○○○○ 1.38 | 1.38385858841336 | 23637626 |
Retrieved 6 of 6 entries in 43.3 ms
(Link to these results)