Bacterial taxon 909946
Locus STM474_2240
Protein WP_000760404.1
DUF2574 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 93 aa, Gene yehE, UniProt E8XCZ3
>WP_000760404.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2574 family protein
MKKYLLMGIIVSAYGISVPVFASDTATLTISGKVTAPTCSTEVVNAQLQQRCGNTIHVSTLQTPAATPMRGVTTQLYTVPGDSTRQIVVNHYD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,245,762 | -3.57 | 2.6e-22 | ●●○○○ -1.68 | -1.67941979017911 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,245,745 | -2.52 | 2.1e-6 | ●●○○○ -1.13 | -1.12915584995043 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,245,745 | -2.45 | 0.00011 | ●●○○○ -1.1 | -1.09627802916198 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,245,762 | -1.66 | 0.13 | ●○○○○ -0.69 | -0.687325769953077 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,245,745 | 0.13 | 1 | ○○○○○ 0.24 | 0.24444113376018 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,245,762 | 0.96 | 0.75 | ○○○○○ 0.68 | 0.676472501067828 | 23637626 |
Retrieved 6 of 6 entries in 2.8 ms
(Link to these results)