Bacterial taxon 909946
Locus STM474_3302
Protein WP_001059119.1
DUF2623 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 95 aa, Gene yghW, UniProt E8XAK2
>WP_001059119.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2623 domain-containing protein
MNNHFGKGLMAGLHAPYAYSAHHAVNFCSEYKRGFVLGFTHRMFEKTGDRQLSAWEAGILTRRYGLDKEMVMDFFKENHSGMAVRFFMAGYRLEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,334,752 | -4.59 | 1.1e-6 | ●●●○○ -2.21 | -2.20780584919346 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,334,752 | -4.59 | 1.7e-5 | ●●●○○ -2.21 | -2.20724311612505 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,334,752 | -3.78 | 1.6e-11 | ●●○○○ -1.79 | -1.78636628526849 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)