Bacterial taxon 909946
Locus STM474_2857
Protein WP_001528723.1
DUF2724 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 64 aa, Gene n/a, UniProt E8XJ82
>WP_001528723.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2724 domain-containing protein
MEEPSFASLLKKQSPAMHCGHGWIIGKDGKRWHPSRSQDELLAGLTTTKRGKPWLLKALRRLFH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,885,318 | -6.87 | 3.0e-9 | ●●●●○ -3.39 | -3.38800213617425 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,885,374 | -5.57 | 1.6e-20 | ●●●○○ -2.71 | -2.71494223837798 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,885,318 | -2.56 | 4.2e-7 | ●●○○○ -1.15 | -1.15123956311293 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,885,374 | -2.25 | 0.013 | ●○○○○ -0.99 | -0.989750120953507 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,885,318 | -2.05 | 0.084 | ●○○○○ -0.89 | -0.886872499817355 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,885,374 | -1.3 | 0.43 | ●○○○○ -0.5 | -0.497064745133392 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)