Bacterial taxon 909946
Locus STM474_3218
Protein WP_000218569.1
DUF296 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 141 aa, Gene n/a, UniProt E8X9P2
>WP_000218569.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF296 domain-containing protein
MTVSHHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,254,173 | 2.09 | 0.0097 | ○○○○○ 1.26 | 1.26410061989463 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,254,173 | 0.29 | 0.86 | ○○○○○ 0.33 | 0.326780984537832 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,254,173 | 0.75 | 0.83 | ○○○○○ 0.57 | 0.565012001930214 | 23637626 |
Retrieved 3 of 3 entries in 2.7 ms
(Link to these results)