Bacterial taxon 909946
Locus STM474_3274
Protein WP_000100106.1
DUF3156 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 185 aa, Gene n/a, UniProt E8XAH4
>WP_000100106.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF3156 family protein
MSSVPWFKSTLMNMVLRDLSGWRCEKLTEHSAVLHLNAFTQVICHAQQKRLFMASIHSCEFRVKGTINYPLQGKIRVHQPGWLKRYPVIFTGSKSTAGLINYLNCFPNLQQALSELDYRRFTLVLHHKEWYCSIELWAASEVVCKMPPLRRYLRLERHQRVLLLSVINMINQAMNQWLQQDTDAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,305,730 | -6.4 | 2.0e-15 | ●●●●○ -3.15 | -3.14788185337967 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,305,605 | -2.96 | 1.8e-6 | ●●○○○ -1.36 | -1.35883997213915 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,305,605 | -2.37 | 0.0082 | ●●○○○ -1.05 | -1.05185166420734 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,305,730 | -1.61 | 0.16 | ●○○○○ -0.66 | -0.661034904906204 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,305,605 | -0.82 | 0.72 | ●○○○○ -0.25 | -0.248409427764099 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,305,730 | 0.52 | 0.96 | ○○○○○ 0.45 | 0.446473218198999 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,305,751 | 0.63 | 0.87 | ○○○○○ 0.5 | 0.50304041770498 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,305,751 | 0.74 | 0.34 | ○○○○○ 0.56 | 0.560796728482902 | 23637626 |
Retrieved 8 of 8 entries in 1.5 ms
(Link to these results)