Bacterial taxon 909946
Locus STM474_4571
Protein WP_000547737.1
DUF350 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 132 aa, Gene yjfL, UniProt E8XAP9
>WP_000547737.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF350 domain-containing protein
MHILDALLAFCAYFFIGAAMVIVFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVIPLSSAAINSVSIPDYFAWGGIALVIQLLIYGCVRLYMPTLSEKIIHHNVAAGLFMGTAALAGGIFNAACMTW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,638,064 | -5.89 | 2.2e-7 | ●●●○○ -2.88 | -2.88072191291038 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,638,140 | -2.06 | 5.3e-5 | ●○○○○ -0.89 | -0.89223298790175 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,638,064 | -1.87 | 0.00053 | ●○○○○ -0.8 | -0.796497015545054 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,638,283 | -0.46 | 0.72 | ●○○○○ -0.06 | -0.0618197394003787 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,638,283 | -0.15 | 0.97 | ○○○○○ 0.1 | 0.100531120209369 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,638,064 | 0.37 | 0.95 | ○○○○○ 0.37 | 0.366802855936329 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,638,283 | 0.48 | 0.48 | ○○○○○ 0.43 | 0.42684444854089 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,638,140 | 0.84 | 0.9 | ○○○○○ 0.61 | 0.614511751824963 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,638,140 | 2.26 | 0.55 | ○○○○○ 1.35 | 1.35113542006856 | 23637626 |
Retrieved 9 of 9 entries in 20.6 ms
(Link to these results)