Bacterial taxon 909946
Locus STM474_0363
Protein WP_000722978.1
DUF4156 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 119 aa, Gene n/a, UniProt E8XJP7
>WP_000722978.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF4156 domain-containing protein
MKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGDITGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSSWHGSGSSKQTNVTLSGNVYRCPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 391,776 | -3.18 | 9.6e-10 | ●●○○○ -1.48 | -1.47625067861912 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 391,776 | -1.69 | 0.19 | ●○○○○ -0.7 | -0.698249509439345 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 391,776 | -1.19 | 0.49 | ●○○○○ -0.44 | -0.439264142002796 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 391,561 | -0.73 | 0.29 | ●○○○○ -0.2 | -0.201391722851164 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 391,561 | -0.55 | 0.82 | ●○○○○ -0.11 | -0.107091612598819 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 391,561 | 0.61 | 0.88 | ○○○○○ 0.49 | 0.493562612432104 | 23637626 |
Retrieved 6 of 6 entries in 9.9 ms
(Link to these results)