Bacterial taxon 909946
Locus STM474_0103
Protein WP_001103147.1
DUF4751 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 139 aa, Gene n/a, UniProt E8XH08
>WP_001103147.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF4751 domain-containing protein
MNVSMQARLVGNDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIWRTEIIENGNAFFHWQGHDRKNGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGHYDNIIEYVSSDHYVYQSAFAEYITDQIHQRAPHGTRF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 117,190 | -4.35 | 1.7e-15 | ●●●○○ -2.08 | -2.081737762264 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 117,190 | -4.04 | 4.3e-5 | ●●○○○ -1.92 | -1.92102991213097 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 117,190 | -0.87 | 0.69 | ●○○○○ -0.28 | -0.276411423915714 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)