Bacterial taxon 909946
Locus STM474_1855
Protein WP_000156280.1
DUF986 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 152 aa, Gene yobd, UniProt E8X8K4
>WP_000156280.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF986 domain-containing protein
MTITDLVLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYNNVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDGVLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,889,080 | -4.82 | 3.5e-15 | ●●●○○ -2.33 | -2.32704995994888 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,889,080 | -0.71 | 0.62 | ●○○○○ -0.19 | -0.192410905922155 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,889,045 | -0.33 | 0.56 | ○○○○○ 0 | 0.00452650582745419 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,889,080 | -0.07 | 0.98 | ○○○○○ 0.14 | 0.142855111695066 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,889,045 | 0.08 | 1 | ○○○○○ 0.22 | 0.218551746251373 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,889,045 | 0.88 | 0.45 | ○○○○○ 0.63 | 0.631898807045754 | 23637626 |
Retrieved 6 of 6 entries in 11.9 ms
(Link to these results)