Bacterial taxon 909946
Locus STM474_1466
Protein WP_000133179.1
electron transport complex subunit RsxA
Salmonella enterica Serovar Typhimurium ST4 74
Length 193 aa, Gene rsxA, UniProt E8XI40
>WP_000133179.1|Salmonella enterica Serovar Typhimurium ST4 74|electron transport complex subunit RsxA
MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,491,615 | -3.59 | 5.5e-12 | ●●○○○ -1.69 | -1.68893105801544 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,491,615 | 0.08 | 1 | ○○○○○ 0.22 | 0.216175104501507 | 23637626 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)