Bacterial taxon 909946
Locus STM474_4051
Protein WP_000116685.1
F0F1 ATP synthase subunit I
Salmonella enterica Serovar Typhimurium ST4 74
Length 126 aa, Gene atpI, UniProt E8XIJ2
>WP_000116685.1|Salmonella enterica Serovar Typhimurium ST4 74|F0F1 ATP synthase subunit I
MSVSLVSRNVARKLLFIQFLAVIASGLLFCLKDPFWGISAVCGGLAVALPNMLFMIFAWRHQAHTPAKGRVSWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPAVINNKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,101,752 | -4.92 | 5.6e-6 | ●●●○○ -2.38 | -2.37812503183942 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,101,752 | -3.15 | 1.7e-6 | ●●○○○ -1.46 | -1.45770372357952 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,101,752 | -2.93 | 0.0054 | ●●○○○ -1.34 | -1.34268233584111 | 23637626 |
Retrieved 3 of 3 entries in 23.8 ms
(Link to these results)