Bacterial taxon 909946
Locus STM474_1373
Protein WP_000418970.1
Fe-S cluster assembly scaffold SufA
Salmonella enterica Serovar Typhimurium ST4 74
Length 122 aa, Gene sufA, UniProt E8XGH4
>WP_000418970.1|Salmonella enterica Serovar Typhimurium ST4 74|Fe-S cluster assembly scaffold SufA
MELHSDTFNPEDFPWQGLTLTPAAAAHIRELAEKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAPLQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,409,191 | -5.73 | 1.3e-6 | ●●●○○ -2.8 | -2.8011388739376 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,409,191 | -1.62 | 0.0014 | ●○○○○ -0.66 | -0.664744638454114 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,409,191 | -0.64 | 0.8 | ●○○○○ -0.16 | -0.157167707839483 | 23637626 |
Retrieved 3 of 3 entries in 17.7 ms
(Link to these results)