Bacterial taxon 909946
Locus STM474_0023
Protein WP_000742554.1
fimbrial chaperone protein BcfB
Salmonella enterica Serovar Typhimurium ST4 74
Length 228 aa, Gene bcfB, UniProt E8XG43
>WP_000742554.1|Salmonella enterica Serovar Typhimurium ST4 74|fimbrial chaperone protein BcfB
MKKNVPIFLRLLLLLSAAGLSFAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNVFLIQSWVANADGSRSTDFIITPPLFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAIPSVDKNKLTGNSLQIATQSVIKLFIRPKNQAEAPAHAPSTLRCRNERGQLTITNPSPYYVSMVELYSAGKKLPNTMVPPKGAITLPATPGQVSLRTVNDFGATTPARVCPAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 25,567 | -2.79 | 3.7e-6 | ●●○○○ -1.27 | -1.26990997131506 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 25,626 | -0.34 | 0.44 | ○○○○○ 0 | 0.00259079707100378 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 25,567 | 0.27 | 0.86 | ○○○○○ 0.32 | 0.316578402865766 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 25,626 | 0.29 | 0.96 | ○○○○○ 0.33 | 0.327432263882301 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 25,567 | 0.37 | 0.95 | ○○○○○ 0.37 | 0.369544051428181 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 25,626 | 1.28 | 0.22 | ○○○○○ 0.84 | 0.84262499163945 | 23637626 |
Retrieved 6 of 6 entries in 2.5 ms
(Link to these results)