Bacterial taxon 909946
Locus STM474_4778
Protein WP_001112032.1
fimbrial protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 235 aa, Gene stjC, UniProt E8XDA6
>WP_001112032.1|Salmonella enterica Serovar Typhimurium ST4 74|fimbrial protein
MPAVTKLPLLLLSVPFVFSTLFSQANAAGMVPETTLLVIEESTHSGVMNVKNTDSNPALLYTTVVDLPDDNGVKLDVTQPVVRVEAGQQQQLRFIMESTEPLTVEHYKRVTFEGIPPKSTDKGMKIGFNLRQDLPVLIRPKNLPVVTDAWKLLTWSRNGQTINVKNPSPYVVRLAQNITFLPSGGEGTIKKTYILPGETLNVSIKTPFAADTSVRFYPASRYGIEVPSFTSPLVP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,849,856 | -9.1 | 5.7e-25 | ●●●●● -4.55 | -4.54823622124762 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,849,856 | -5.22 | 4.0e-7 | ●●●○○ -2.53 | -2.53309284389484 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,850,102 | -3.21 | 4.5e-5 | ●●○○○ -1.49 | -1.49192919567358 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,849,856 | -2.92 | 0.0062 | ●●○○○ -1.34 | -1.33790359657231 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,850,102 | -2.65 | 0.016 | ●●○○○ -1.2 | -1.19732167581512 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,850,102 | -1.98 | 0.002 | ●○○○○ -0.85 | -0.851165463846121 | 23637626 |
Retrieved 6 of 6 entries in 2.7 ms
(Link to these results)