Bacterial taxon 909946
Locus STM474_1673
Protein WP_001574288.1
fumarate/nitrate reduction transcriptional regulator Fnr
Salmonella enterica Serovar Typhimurium ST4 74
Length 264 aa, Gene fnr, UniProt E8XJZ0
>WP_001574288.1|Salmonella enterica Serovar Typhimurium ST4 74|fumarate/nitrate reduction transcriptional regulator Fnr
MLKLTNINYGLSRPMIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGSGHHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENSDALAALAGHTRNVA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,711,432 | -7.77 | 2.0e-9 | ●●●●○ -3.86 | -3.85823372685163 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,711,432 | 1.48 | 0.051 | ○○○○○ 0.94 | 0.944584960291935 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,711,432 | 1.64 | 0.27 | ○○○○○ 1.03 | 1.02886779854119 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)