Bacterial taxon 909946
Locus STM474_3703
Protein WP_000253995.1
glucose-1-phosphate adenylyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 431 aa, Gene glgC, UniProt E8XEN9
>WP_000253995.1|Salmonella enterica Serovar Typhimurium ST4 74|glucose-1-phosphate adenylyltransferase
MVSLEKNDRVMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWSLFSEEMNEFVDLLPAQQRMKGENWYRGTADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIKEATAFGVMAVDESDKIIDFVEKPANPPAMPGDASKSLASMGIYVFDADYLYELLAADDKDDASSHDFGKDIIPKITREGMAYAHPFPLSCVQSDPQAEPYWRDVGTLEAYWKANLDLASVTPELDMYDQNWPIRTHMESLPPAKFVQDRSGSHGMTLNSLVSGGCIISGSVVVQSVLFPRVRINSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACIIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLQVKQER
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,725,191 | 1.74 | 0.017 | ○○○○○ 1.08 | 1.07940846078828 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,724,812 | 2.07 | 0.012 | ○○○○○ 1.25 | 1.25027766731346 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,725,204 | -0.07 | 0.93 | ○○○○○ 0.14 | 0.139257789011969 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,725,191 | 0.02 | 0.86 | ○○○○○ 0.19 | 0.186241527106855 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,724,991 | 0.17 | 0.92 | ○○○○○ 0.26 | 0.263034159286059 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,724,644 | 0.3 | 0.96 | ○○○○○ 0.33 | 0.333434872157408 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,724,812 | 0.3 | 0.83 | ○○○○○ 0.33 | 0.333654164743185 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,725,204 | 0.43 | 0.93 | ○○○○○ 0.4 | 0.39814347814207 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,725,191 | 0.58 | 0.89 | ○○○○○ 0.48 | 0.47963032280996 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,724,189 | 0.68 | 0.71 | ○○○○○ 0.53 | 0.531899657055177 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,724,189 | 1.38 | 0.79 | ○○○○○ 0.89 | 0.894815629450948 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,724,991 | 1.44 | 0.48 | ○○○○○ 0.92 | 0.923745479504637 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,724,792 | 1.68 | 0.71 | ○○○○○ 1.05 | 1.05081770507231 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,724,792 | 1.89 | 0.2 | ○○○○○ 1.16 | 1.15815179330134 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,724,812 | 1.9 | 0.25 | ○○○○○ 1.16 | 1.16344282096436 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,724,644 | 2.26 | 0.12 | ○○○○○ 1.35 | 1.35283179328752 | 23637626 |
Retrieved 16 of 16 entries in 2.9 ms
(Link to these results)