Bacterial taxon 909946
Locus STM474_0855
Protein WP_000838671.1
glutamine ABC transporter substrate-binding protein GlnH
Salmonella enterica Serovar Typhimurium ST4 74
Length 248 aa, Gene glnH, UniProt E8XBU2
>WP_000838671.1|Salmonella enterica Serovar Typhimurium ST4 74|glutamine ABC transporter substrate-binding protein GlnH
MKSLLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVDLWDAIAKELKLDYTLKPMDFSGIIPALQTKNIDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDIKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGESLEAQQYGVAFPKGSDELREKVNGALKTLRENGTYNEIYKKWFGTEPK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 895,625 | 1.65 | 0.028 | ○○○○○ 1.03 | 1.03454110415766 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 895,845 | -0.41 | 0.57 | ●○○○○ -0.04 | -0.0378659962529966 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 895,845 | 1.14 | 0.65 | ○○○○○ 0.77 | 0.771371178662374 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 895,625 | 1.59 | 0.5 | ○○○○○ 1 | 1.00151695554056 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 895,845 | 2.01 | 0.19 | ○○○○○ 1.22 | 1.22107635691355 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 895,625 | 2.45 | 0.28 | ○○○○○ 1.45 | 1.44753892787848 | 23637626 |
Retrieved 6 of 6 entries in 2.5 ms
(Link to these results)