Bacterial taxon 909946
Locus STM474_2540
Protein WP_001263761.1
GMP synthase
Salmonella enterica Serovar Typhimurium ST4 74
Length 239 aa, Gene yfeJ, UniProt E8XFP6
Protein visualisation (by ProViz)
>WP_001263761.1|Salmonella enterica Serovar Typhimurium ST4 74|GMP synthase
MRVHFVVHESFESAGAYLKWAEDRGYTISWSRVYAGEALPPNADEFDMLVVFGGPQSPRTTREECPYFDSRAEQHLINQAVTARRMVIGICLGSQLIGEALGAAVCQSPEKEIGHYPITLTEAGLRHPLIAHFGSPLTVGHWHNDMPGLTDQATVLAESEGCPRQIVQYGNFVYGFQCHMEFTVEAVEGLIQHSQQELADAQGKRFIRSVAEMRAWNYQQMNEKLWRFLDELTLAHSQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,547,602 | 1.54 | 0.035 | ○○○○○ 0.98 | 0.978671204628222 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,547,602 | 1.15 | 0.42 | ○○○○○ 0.77 | 0.773229404623611 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,547,602 | 1.37 | 0.52 | ○○○○○ 0.89 | 0.889406942209221 | 23637626 |
Retrieved 3 of 3 entries in 162.1 ms
(Link to these results)