Bacterial taxon 909946
Locus STM474_0827
Protein WP_000168180.1
GTP 3',8-cyclase MoaA
Salmonella enterica Serovar Typhimurium ST4 74
Length 329 aa, Gene moaA, UniProt E8XBR5
>WP_000168180.1|Salmonella enterica Serovar Typhimurium ST4 74|GTP 3',8-cyclase MoaA
MASQLTDAFARKFYYLRLSITDVCNFRCTYCLPDGYKPGGVTNNGFLTVDEIRRVTRAFASLGTEKVRLTGGEPSLRRDFTDIIAAVGENDAIRQIAVTTNGYRLARDAANWREAGLTGVNVSVDSLDARQFHAITGQDKFRQVMAGIDAAFDAGFEKVKVNTVLMRDVNHHQLDTFLAWIQPRPIQLRFIELMETGEGSDLFRKHHISGQVLRDELIKRGWIHQLRQRSDGPAQVFCHPDYAGEIGLIMPYEKDFCATCNRLRVSSVGKLHLCLFGDGGVSLRDLLQDDAQQYALEERISDALREKKQTHFLHQSNTGITQNLSYIGG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 870,842 | -8.79 | 2.9e-9 | ●●●●● -4.39 | -4.38709269047028 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 870,377 | -3.41 | 0.0024 | ●●○○○ -1.59 | -1.59493070452991 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 870,842 | 2.1 | 0.0052 | ○○○○○ 1.27 | 1.26936725274856 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 870,842 | -0.42 | 0.76 | ●○○○○ -0.04 | -0.0421207350226377 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 870,377 | 0.19 | 0.94 | ○○○○○ 0.28 | 0.275035420735345 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 870,377 | 0.28 | 0.65 | ○○○○○ 0.32 | 0.32417209070329 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)