Bacterial taxon 909946
Locus STM474_0493
Protein WP_001280991.1
hemolysin expression modulator Hha
Salmonella enterica Serovar Typhimurium ST4 74
Length 72 aa, Gene hha, UniProt E8X859
>WP_001280991.1|Salmonella enterica Serovar Typhimurium ST4 74|hemolysin expression modulator Hha
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,636 | -9.66 | 1.2e-10 | ●●●●● -4.84 | -4.83914205330117 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,792 | -8.59 | 1.2e-8 | ●●●●● -4.29 | -4.28602252449153 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 527,725 | -5.72 | 2.1e-17 | ●●●○○ -2.79 | -2.79308736447257 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,725 | -4.88 | 9.0e-6 | ●●●○○ -2.36 | -2.35899542022209 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 527,792 | -4 | 0.00079 | ●●○○○ -1.9 | -1.90065115542116 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 527,636 | -3.85 | 0.006 | ●●○○○ -1.82 | -1.82482340376442 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 527,636 | 1.73 | 0.015 | ○○○○○ 1.07 | 1.07349752194798 | 23637626 |
Retrieved 7 of 7 entries in 9.7 ms
(Link to these results)