Bacterial taxon 909946
Locus STM474_3728
Protein WP_000082083.1
high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG
Salmonella enterica Serovar Typhimurium ST4 74
Length 255 aa, Gene livG, UniProt E8XF73
>WP_000082083.1|Salmonella enterica Serovar Typhimurium ST4 74|high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG
MSQPLLAVNGLMMRFGGLLAVNNVSLELREREIVSLIGPNGAGKTTVFNCLTGFYKPTGGTITLRERHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPAFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEEIRNNPDVIRAYLGEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,751,068 | 1.85 | 0.008 | ○○○○○ 1.14 | 1.14011149832301 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,750,726 | 2.37 | 0.0041 | ○○○○○ 1.41 | 1.40812414525746 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,750,726 | 0.34 | 0.95 | ○○○○○ 0.36 | 0.356154564094716 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,750,726 | 0.47 | 0.74 | ○○○○○ 0.42 | 0.41981487982277 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,751,068 | 1.92 | 0.25 | ○○○○○ 1.18 | 1.17554422550677 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,751,068 | 1.94 | 0.12 | ○○○○○ 1.18 | 1.18360800741732 | 23637626 |
Retrieved 6 of 6 entries in 2.3 ms
(Link to these results)