Bacterial taxon 909946
Locus STM474_1546
Protein WP_000852664.1
HyaD/HybD family hydrogenase maturation endopeptidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 202 aa, Gene n/a, UniProt E8XIY2
>WP_000852664.1|Salmonella enterica Serovar Typhimurium ST4 74|HyaD/HybD family hydrogenase maturation endopeptidase
MAEVTILGLGNLLWADEGFGVRAAEKLFEQYADNEKVDVVDGGTQGLALLPWLQQTEKLLIMDAIDFGMAPGSLAMFRDEQVPAYLTAKKLSLHQTSFSEVLALLQLTGGQLSEIVLIGVQPECLDDYGGSLTPQVKAQLMPAVYLAQEVLAQWGITASSAALPTERLNHYSLCMERYEDERPDAQSACRVGDIRVLQREKS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,567,992 | 2.73 | 0.00058 | ○○○○○ 1.6 | 1.59503536733157 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,567,992 | -1.34 | 0.29 | ●○○○○ -0.52 | -0.517218366447485 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,567,755 | -0.67 | 0.62 | ●○○○○ -0.17 | -0.17149414435307 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,567,755 | 0.04 | 0.9 | ○○○○○ 0.2 | 0.196492072686683 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,567,755 | 0.09 | 1 | ○○○○○ 0.22 | 0.223062763201322 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,567,992 | 1.54 | 0.44 | ○○○○○ 0.98 | 0.975774109818072 | 23637626 |
Retrieved 6 of 6 entries in 60.1 ms
(Link to these results)