Bacterial taxon 909946
Locus STM474_0017
Protein WP_001068132.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 177 aa, Gene n/a, UniProt E8XG37
Protein visualisation (by ProViz)
>WP_001068132.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMRDLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFNHEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHNNEQFIYGWIKNRVT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 16,626 | -3.96 | 8.9e-8 | ●●○○○ -1.88 | -1.87719354946081 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 16,626 | -2.27 | 0.18 | ●●○○○ -1 | -1.00385386856303 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 16,626 | -1.64 | 0.23 | ●○○○○ -0.68 | -0.675521098727163 | 23637626 |
Retrieved 3 of 3 entries in 32.7 ms
(Link to these results)