Bacterial taxon 909946
Locus STM474_0203
Protein WP_001526021.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 68 aa, Gene fhuB, UniProt E8XHZ2
>WP_001526021.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLNPTYKLHNINMLWQYFVGLKIAERYQVRELSCHVLSRELCFYFQQEAGVIFVSISHELFQWRAAVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 229,949 | -2.27 | 5.3e-9 | ●●○○○ -1 | -1.00378660795881 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 229,949 | -0.61 | 0.63 | ●○○○○ -0.14 | -0.139908300696776 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 229,949 | 0.53 | 0.97 | ○○○○○ 0.45 | 0.453136522033122 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)