Bacterial taxon 909946
Locus STM474_0303
Protein WP_000932531.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 87 aa, Gene rhs1, UniProt E8XIV6
>WP_000932531.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLNKFKLWVSKHTDYTVIHNENDLSYSIIIDFEDDRYISRFTVWDDLSCMSEVMDVDTGLYKLNKRNEFSTFDELLDIFDDFMISIK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 336,271 | -4.01 | 2.2e-13 | ●●○○○ -1.91 | -1.90565955487485 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 336,271 | -2.62 | 0.022 | ●●○○○ -1.18 | -1.18462123706657 | 23637626 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)