Bacterial taxon 909946
Locus STM474_0305
Protein WP_000935097.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 148 aa, Gene n/a, UniProt E8XIV8
>WP_000935097.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLNSNMSELRIELENAIKNLGIHDYRVDKPEQIVSEIKEIYVNGNPRTWWLSLKHRQYVFSYTDNSGYKNISQIVSKQLNESNVINKHIFLIADEDNEQIYVYNVPLNSLPEIIENCRYFEYYVADHELSWLICENDHGDLIVCSTIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 337,429 | -4.38 | 1.4e-8 | ●●●○○ -2.1 | -2.0958512407928 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 337,429 | -4.2 | 6.6e-14 | ●●●○○ -2 | -2.00234717717283 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 337,429 | -0.69 | 0.9 | ●○○○○ -0.18 | -0.183298928270279 | 23637626 |
Retrieved 3 of 3 entries in 2 ms
(Link to these results)