Bacterial taxon 909946
Locus STM474_0741
Protein WP_001194239.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 246 aa, Gene n/a, UniProt E8XAV2
>WP_001194239.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MQTLTRVLPPLRLIMFCQSGENPTQFPDTGGLCVEDCVRLRTPEGLLDRLRRWPGAMVISAGRPSTQLLLWQQVFLRYPRTVVFCSSNAFLPVDVSVEGYFRHLRLIKRAMSVRVLARMAELAIWSSLQTSPYEEEMKSALSVPELVMEINSRTLVRLLSERLPKQGRRVLGLLLSGCSPEMTARMLGTGVRQVWLAEQTLKQRWDIPTGVPLSDAVRIRIPDVGPDISQQSGLVKTGAGNAPDLC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 782,785 | -7.05 | 1.7e-26 | ●●●●○ -3.49 | -3.48606936061612 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 782,785 | -4.16 | 0.00013 | ●●○○○ -1.98 | -1.98310212033476 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 783,099 | -2.2 | 0.032 | ●○○○○ -0.96 | -0.964814543215915 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 783,099 | -1.86 | 0.00035 | ●○○○○ -0.79 | -0.788162541874078 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 782,523 | 1.85 | 0.01 | ○○○○○ 1.14 | 1.13645462997521 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 782,785 | -1.03 | 0.74 | ●○○○○ -0.36 | -0.357792902223 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 783,099 | -0.26 | 0.94 | ○○○○○ 0.04 | 0.0405616884627457 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 782,523 | 0.05 | 0.98 | ○○○○○ 0.2 | 0.202356411859003 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 782,523 | 1.04 | 0.7 | ○○○○○ 0.72 | 0.715257806215051 | 23637626 |
Retrieved 9 of 9 entries in 42.4 ms
(Link to these results)