Bacterial taxon 909946
Locus STM474_1007
Protein WP_014343823.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 96 aa, Gene n/a, UniProt E8XDH0
>WP_014343823.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNYEDKLMYQRMIFEEGKEPRLYSSQHDSKFIPISNNNGKVQKVPVMEFKDTRGDVFYAYNYAYSGKKPSNDEIYKAIDELKPIGEKFEMSKTISD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,065,362 | -2.18 | 0.016 | ●○○○○ -0.96 | -0.957161639478537 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,065,428 | 0.24 | 1 | ○○○○○ 0.3 | 0.303300749438458 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,065,428 | 0.35 | 0.82 | ○○○○○ 0.36 | 0.36041438591686 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,065,362 | 0.36 | 0.95 | ○○○○○ 0.37 | 0.365676797780725 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,065,428 | 0.95 | 0.28 | ○○○○○ 0.67 | 0.668440152238799 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,065,362 | 1.41 | 0.084 | ○○○○○ 0.91 | 0.907258446032687 | 23637626 |
Retrieved 6 of 6 entries in 1.1 ms
(Link to these results)