Bacterial taxon 909946
Locus STM474_1782
Protein WP_014344081.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 61 aa, Gene narK, UniProt E8X8D1
>WP_014344081.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPLFSTIQRSIPIPITSYSLIAAVERYLRREGVDRHSMVKNHSFFTKIAYSLRVITIFSRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,820,995 | -2.27 | 4.9e-5 | ●●○○○ -1 | -1.00233551279571 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,820,995 | -0.05 | 0.97 | ○○○○○ 0.15 | 0.149039628647027 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,820,995 | 0.27 | 1 | ○○○○○ 0.32 | 0.317640217116375 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)