Bacterial taxon 909946
Locus STM474_2027
Protein WP_024131109.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 62 aa, Gene ompS, UniProt E8XB17
>WP_024131109.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MTNKIHFRCPCCHGSQYRTSTFDVTEQNPFGAKCIFCKSTMITFDNVGLYIRSGQVPPDFRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,036,714 | -4.88 | 1.6e-34 | ●●●○○ -2.36 | -2.35872087047259 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,036,714 | -2.25 | 0.049 | ●○○○○ -0.99 | -0.990965371412685 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,036,714 | -0.54 | 0.71 | ●○○○○ -0.1 | -0.104672902721235 | 23637626 |
Retrieved 3 of 3 entries in 42.8 ms
(Link to these results)