Bacterial taxon 909946
Locus STM474_2047
Protein WP_001135697.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 170 aa, Gene n/a, UniProt E8XB35
>WP_001135697.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPQKAYLHVDFVQPEELVFNRARMRRAFVKIGQVHMRDARRLVMKRGRSKPGENPSYRTGQLARSIGYYVPRASKKRPGLMVKIAPNQKNGEGNRHINGAFYPAFLFYGVRRGAKRKKGHHRGASGGSGWRVEPRNNYMTEVLDKRRSWTRYVLSRELRKSLRPQRRKKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,054,168 | 1.5 | 0.0061 | ○○○○○ 0.96 | 0.958062224796356 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,054,168 | 0.66 | 0.58 | ○○○○○ 0.52 | 0.521722019627173 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,054,168 | 0.87 | 0.79 | ○○○○○ 0.63 | 0.626691130434317 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)