Bacterial taxon 909946
Locus STM474_2608
Protein WP_014343875.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 78 aa, Gene n/a, UniProt E8XGJ6
>WP_014343875.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MYLEAINVTGVVPRGLPLVGRTGCPELLKIGCASYREFNHAEGYRVLYSVEGILVTAHVILSPRQDIPRLLFKRLIMA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,619,374 | -2.46 | 9.3e-7 | ●●○○○ -1.1 | -1.10012886571312 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,619,379 | -1.95 | 0.0012 | ●○○○○ -0.83 | -0.833986097123635 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,619,374 | -1.42 | 0.028 | ●○○○○ -0.56 | -0.561647134271345 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,619,379 | -1.34 | 0.39 | ●○○○○ -0.52 | -0.517851864975174 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,619,374 | -1.15 | 0.51 | ●○○○○ -0.42 | -0.422428758966143 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,619,379 | -0.27 | 0.85 | ○○○○○ 0.04 | 0.0393464141150902 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)