Bacterial taxon 909946
Locus STM474_2897
Protein WP_077248271.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 67 aa, Gene n/a, UniProt E8XJC2
>WP_077248271.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MERFNRTYCTEILDFYLFRTLNEVREITERWVSEYNCERPHESLNNMTPEEYRQHNHLTGISKNAWN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,928,964 | -7.44 | 1.3e-20 | ●●●●○ -3.69 | -3.6852411057829 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,928,964 | -1.31 | 0.31 | ●○○○○ -0.5 | -0.501511024310045 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,928,964 | -0.33 | 0.92 | ○○○○○ 0.01 | 0.0081233621659298 | 23637626 |
Retrieved 3 of 3 entries in 41.8 ms
(Link to these results)