Bacterial taxon 909946
Locus STM474_2915
Protein WP_001521746.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 65 aa, Gene virK, UniProt E8XK21
>WP_001521746.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNSAALNRRFHSCYDQHLNLIPFTITSSISMLTIKYKLNICHIFIWLSKKIIQNSIFSKLSQEFW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,951,994 | -7.66 | 3.4e-18 | ●●●●○ -3.8 | -3.80262804634392 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,951,994 | -6.85 | 8.0e-9 | ●●●●○ -3.38 | -3.38179195209213 | 23637626 |
Retrieved 2 of 2 entries in 24.8 ms
(Link to these results)