Bacterial taxon 909946
Locus STM474_3019
Protein WP_000692254.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 86 aa, Gene n/a, UniProt E8XL08
>WP_000692254.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKIITHVVPGSGMAAIYDDIADSSRFVIKGKLRHVENDPKELLICVPMRSEWLFYWIKGEKYCARRWARKSIKTLCNQIKFEEAIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,046,816 | -2.22 | 0.00082 | ●○○○○ -0.98 | -0.975104510495635 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,046,791 | -2.15 | 0.019 | ●○○○○ -0.94 | -0.941258150612499 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,046,791 | -1.31 | 0.076 | ●○○○○ -0.5 | -0.503047428860544 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,046,816 | -0.46 | 0.71 | ●○○○○ -0.06 | -0.064184446259294 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,046,791 | -0.4 | 0.89 | ●○○○○ -0.03 | -0.0324548422663383 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,046,816 | 0.28 | 0.97 | ○○○○○ 0.32 | 0.323253198096066 | 23637626 |
Retrieved 6 of 6 entries in 1.4 ms
(Link to these results)