Bacterial taxon 909946
Locus STM474_3233
Protein WP_000032793.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 243 aa, Gene n/a, UniProt E8XAD5
>WP_000032793.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSKFKFNAVIVGLFLLLGGCSSGMQSNNGSSSDVGTAWGGDVHSSVQSVSVERADREPAEMVIINYSTQYPSGYDKVYSIRISDLEYAVRDANFNSIPITRRYNASMGQWQYSIPARSGMNYQLYIRNYSHDTNYEIVATVDGLDVLNGKAGSLNHHGYIVNAGDSLAIKGFRKDKHTEAAFQFADVADAYAAHSAQGDVRNIGVIGFAAFALQGKATNTLPPCSSQAFPADNNGYAPPPCRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,268,907 | -4.49 | 4.6e-32 | ●●●○○ -2.15 | -2.15416802042694 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,268,916 | -3.18 | 0.0014 | ●●○○○ -1.48 | -1.47546774987663 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,268,907 | -2.91 | 0.0036 | ●●○○○ -1.34 | -1.33643197497549 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,268,916 | -2.86 | 1.8e-14 | ●●○○○ -1.31 | -1.30594953073483 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,268,907 | -1.69 | 0.2 | ●○○○○ -0.7 | -0.701695993526114 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,268,916 | -0.91 | 0.77 | ●○○○○ -0.29 | -0.294552057768828 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,269,010 | -0.9 | 0.67 | ●○○○○ -0.29 | -0.289875422525551 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,269,010 | -0.89 | 0.44 | ●○○○○ -0.28 | -0.283806584485951 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,269,010 | -0.03 | 0.98 | ○○○○○ 0.16 | 0.163710302791346 | 23637626 |
Retrieved 9 of 9 entries in 1.5 ms
(Link to these results)