Bacterial taxon 909946
Locus STM474_3860
Protein WP_001062558.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 69 aa, Gene n/a, UniProt E8XG02
>WP_001062558.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MAKIGENVPLLIDKAVDFMASSQAFREYLNKTPPRDYVPSEVPSESAPIYLQRLEYYRRLYRPKEEERG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,900,544 | -2.19 | 0.027 | ●○○○○ -0.96 | -0.962540754862711 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,900,544 | -1.96 | 0.0006 | ●○○○○ -0.84 | -0.841469772811049 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,900,544 | -0.31 | 0.93 | ○○○○○ 0.02 | 0.0186693682218717 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)