Bacterial taxon 909946
Locus STM474_4065
Protein WP_001738602.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 81 aa, Gene rbsR, UniProt E8XIK6
>WP_001738602.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MTSKKARSMAGLPWIAAMAFFMQALDATILNTALPAIAHSLNRSPLAMQSAIISYTLTVAMLIPVSGWLTALVRVAFLWLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,120,217 | -2.09 | 0.042 | ●○○○○ -0.91 | -0.907154348245446 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,120,217 | -0.51 | 0.87 | ●○○○○ -0.09 | -0.0852395532704293 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,120,217 | -0.34 | 0.65 | ●○○○○ -0 | -0.00110383116957532 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)