Bacterial taxon 909946
Locus STM474_4233
Protein WP_000378721.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 227 aa, Gene n/a, UniProt E8XKB8
>WP_000378721.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MDSVMRKSLFLLLPLVVTNAHAVYVDVRHEYLDDSKANYDRAYISHRFANGVGFAIEAISKSGGDDTNKAFNDLETQGNEYTISYQFKTGDVAWQPGFVLETGNGYSTYKPYFRATWTLNESWWVGARYRFEYVRRSSDIRDDDTINRMDVWAGYKWNNFDWTIEGIYKKADKYDLYDGGKDNYEYNFRTAYIIDQWSPFVEVGNVSVNSNSDERQTRFRVGIGYTF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,284,600 | -2.87 | 4.0e-5 | ●●○○○ -1.31 | -1.31448383047922 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,284,600 | -1.74 | 0.39 | ●○○○○ -0.73 | -0.725036644617824 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,284,600 | -1.38 | 0.36 | ●○○○○ -0.54 | -0.537006768258115 | 23637626 |
Retrieved 3 of 3 entries in 2.5 ms
(Link to these results)