Bacterial taxon 909946
Locus STM474_4341
Protein WP_010989089.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 114 aa, Gene n/a, UniProt E8XLA1
>WP_010989089.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLQKKTNPMIKNFNFEYCGFSTFITPVDGVGGILVKWLSNKHNVIVPTPYTFGQDPIPGVNLYRNTKAKFVMANGGNSLPCAMAKYNTKTGQFIHITSDNDFSPIIRETRVMKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,396,116 | -2.61 | 0.017 | ●●○○○ -1.18 | -1.17823297321504 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,396,116 | -1.19 | 0.061 | ●○○○○ -0.44 | -0.443307254829906 | 23637626 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)