Bacterial taxon 909946
Locus STM474_4344
Protein WP_001526923.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 62 aa, Gene n/a, UniProt E8XLA4
>WP_001526923.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MGSPLIPVVLGHHFMDKNDQQTRLEEGPPAKLQSGTLPENFKFTAISIIQWPAPGRQLLMKG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,398,175 | -6.97 | 7.0e-27 | ●●●●○ -3.44 | -3.44486344178355 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,398,175 | -4.3 | 1.8e-5 | ●●●○○ -2.06 | -2.05762755166802 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,398,175 | -2.44 | 0.027 | ●●○○○ -1.09 | -1.09166592033091 | 23637626 |
Retrieved 3 of 3 entries in 24.9 ms
(Link to these results)