Bacterial taxon 909946
Locus STM474_4506
Protein WP_010989096.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 89 aa, Gene n/a, UniProt E8X9W2
>WP_010989096.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MDTQPSAEPTLGSTVSSLDNTVTLKGVVEAHQDIQVKVTVNDTDYTASGTFTGTSPTKNPVNKSSGVDEMISLSEATWHSVSVDEENHA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,580,876 | -10.41 | 4.8e-50 | ●●●●● -5.23 | -5.22819451353696 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,580,876 | -8.13 | 1.4e-10 | ●●●●● -4.05 | -4.04677799586881 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,580,876 | -4.34 | 3.9e-5 | ●●●○○ -2.08 | -2.07783085789886 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)