Bacterial taxon 909946
Locus STM474_4602
Protein WP_071527475.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 77 aa, Gene n/a, UniProt E8XAT0
>WP_071527475.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MTIDHIYVVSSVHKYIYLLITVIQNYLNISSFFSVYAFIFHRKCAPARKLASPLREKASIAHMINYRPKVVGSPAKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,663,868 | -2.22 | 0.0019 | ●○○○○ -0.98 | -0.975207014912804 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,663,868 | 0.73 | 0.84 | ○○○○○ 0.56 | 0.556298204687231 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,663,868 | 0.78 | 0.58 | ○○○○○ 0.58 | 0.583936713769298 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)