Bacterial taxon 909946
Locus STM474_4724
Protein WP_001595639.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 47 aa, Gene n/a, UniProt E8XCG6
>WP_001595639.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MVVWGGSRKIPYRPPHRTENAGIMNVCTNNTGIKSTVSATWINKEGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,796,609 | -2.13 | 0.0012 | ●○○○○ -0.93 | -0.927556556688807 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,796,609 | -1.81 | 0.00052 | ●○○○○ -0.76 | -0.761077433774859 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,796,609 | -2.07 | 0.11 | ●○○○○ -0.9 | -0.896893323933149 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)