Bacterial taxon 909946
Locus STM474_2895
Protein WP_000088556.1
integrase
Salmonella enterica Serovar Typhimurium ST4 74
Length 291 aa, Gene n/a, UniProt E8XJC0
>WP_000088556.1|Salmonella enterica Serovar Typhimurium ST4 74|integrase
MSRLAQDMKKLAHRAGGSHKTVHDREQMAQRFARHLLAQNIQVTSTCQLKARHIAGYIHEWLAQGISLRTLQNEMAMVRSILAEAGRTQLSQSELISNQSLGISGASCDGTHRAIPDALYHQVLDRVHHIDAGLAASLQLARVMGLRGQEAVQCCQSLKTWDKQLEKGAERLPVIFGTKGGRPRMTQVTDREAVRQAVKEALGIAGERNGHLIDKPDLKSAMDYWHNHLRDTGLTGEYSPHSLRYAWAQDAIRYYEEQGLSHKEALAVTSTDLGHGDGRGIYIEQVYGYTD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,923,463 | -4.18 | 1.2e-14 | ●●○○○ -1.99 | -1.99167344150639 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,923,463 | -2.51 | 0.042 | ●●○○○ -1.13 | -1.12785767791295 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,923,250 | -1.15 | 0.045 | ●○○○○ -0.42 | -0.42175912236555 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,923,250 | -2.83 | 0.065 | ●●○○○ -1.29 | -1.29018682289689 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,923,463 | -1.73 | 0.12 | ●○○○○ -0.72 | -0.720110746616824 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,923,744 | -0.65 | 0.64 | ●○○○○ -0.16 | -0.161524316423702 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,923,250 | -0.4 | 0.89 | ●○○○○ -0.03 | -0.0295108014052816 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,923,744 | 0.32 | 1 | ○○○○○ 0.34 | 0.343265206439874 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,923,744 | 1.15 | 0.14 | ○○○○○ 0.77 | 0.773383344048147 | 23637626 |
Retrieved 9 of 9 entries in 1.3 ms
(Link to these results)